PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012574996.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 168aa    MW: 20154.6 Da    PI: 10.8109
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012574996.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.83.8e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +rienk+nrqvtfskRr g+lKKA+EL+vLCdaeva+iifss+gkl+ yss
  XP_012574996.1  9 ERIENKINRQVTFSKRRSGLLKKAFELCVLCDAEVALIIFSSRGKLFQYSS 59
                    69***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.8E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.964161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-32278IPR002100Transcription factor, MADS-box
CDDcd002653.13E-39278No hitNo description
PRINTSPR004041.0E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGRGRVVLER IENKINRQVT FSKRRSGLLK KAFELCVLCD AEVALIIFSS RGKLFQYSST  60
DISKIIERYR QCRYNKLQAA NSFGHESQNI YQEYLKLKGK YESLDRRQRR RSYCHELRNY  120
VKRCITWRSL TKNWSPREWM NSQTSLLTKI AIFNCMLYKP IILNKRKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1c7u_A4e-23276173MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
1c7u_B4e-23276173MYOCYTE-SPECIFIC ENHANCER FACTOR 2A, C4 FORM
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104110DRRQRRR
2105110RRQRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1372893e-91BT137289.1 Medicago truncatula clone JCVI-FLMt-16G17 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574996.11e-121PREDICTED: developmental protein SEPALLATA 1-like isoform X2
SwissprotP293821e-43SEP1_ARATH; Developmental protein SEPALLATA 1
TrEMBLA0A072UC001e-62A0A072UC00_MEDTR; MADS-box transcription factor
TrEMBLI3S9Z27e-64I3S9Z2_MEDTR; Uncharacterized protein
STRINGGLYMA09G27461.11e-57(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.16e-45MIKC_MADS family protein